PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG063000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 196aa    MW: 22286.5 Da    PI: 9.2282
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG063000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.97.3e-251056248
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                         rien   r vtfskRr+g+lKKA ELSvLC+a+v viifsstgk+++
  Pavir.3KG063000.1.p 10 RIENPVHRRVTFSKRREGLLKKARELSVLCGADVGVIIFSSTGKVHD 56
                         8********************************************97 PP

2K-box30.51.6e-117916513100
                K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                          +++  +q ++ L+ ei  Lq+  R + G + e++ l  L+ Le+ Le    + Rs+K++++ ++i+ l++ke  l+++n+ L++k++e
  Pavir.3KG063000.1.p  79 QSQVTEQWISLLRHEIGLLQHGSRSI-GGGEENMRLDRLHVLEKGLELWYWQTRSTKMQIMQQEIQVLKNKESILKSANEILQQKVNE 165
                          56677888999**********96666.5555******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.539161IPR002100Transcription factor, MADS-box
SMARTSM004329.4E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-25170IPR002100Transcription factor, MADS-box
CDDcd002651.27E-31361No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-24323IPR002100Transcription factor, MADS-box
PfamPF003198.4E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.91773169IPR002487Transcription factor, K-box
PfamPF014864.7E-1279163IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MVRGKVQMRR IENPVHRRVT FSKRREGLLK KARELSVLCG ADVGVIIFSS TGKVHDLATN  60
GEVPEHIAAR GKMESMNLQS QVTEQWISLL RHEIGLLQHG SRSIGGGEEN MRLDRLHVLE  120
KGLELWYWQT RSTKMQIMQQ EIQVLKNKES ILKSANEILQ QKVNEQNQFM SNCSVFSGSS  180
YSTHYDADES CLFTI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700445.13e-74PREDICTED: MADS-box transcription factor 33-like
SwissprotQ2QW552e-73MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA3CFV13e-73A3CFV1_ORYSJ; Uncharacterized protein
TrEMBLA2ZIY83e-73A2ZIY8_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0J7X23e-73A0A0E0J7X2_ORYNI; Uncharacterized protein
TrEMBLA0A0E0BQC53e-73A0A0E0BQC5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0FAI84e-73A0A0E0FAI8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA036463-PA9e-73(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.14e-44AGAMOUS-like 12